Anti-CIITA

Catalog Number: ATA-HPA054757
Article Name: Anti-CIITA
Biozol Catalog Number: ATA-HPA054757
Supplier Catalog Number: HPA054757
Alternative Catalog Number: ATA-HPA054757-100,ATA-HPA054757-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C2TA, MHC2TA, NLRA
Clonality: Polyclonal
Isotype: IgG
NCBI: 4261
UniProt: P33076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT
Target: CIITA
Antibody Type: Monoclonal Antibody
HPA054757-100ul