Anti-RTRAF, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RTRAF, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA054777
• Supplier Catalog Number: HPA054777
• Alternative Catalog Number: ATA-HPA054777-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: CGI-99, CLE, CLE7, LCRP369, RLLM1

Product Description

Rabbit Polyclonal RTRAF Antibody against Human RNA transcription, translation and transport factor. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 51637
• UniProt: Q9Y224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: AGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVG