Anti-RTRAF

Catalog Number: ATA-HPA054777
Article Name: Anti-RTRAF
Biozol Catalog Number: ATA-HPA054777
Supplier Catalog Number: HPA054777
Alternative Catalog Number: ATA-HPA054777-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: CGI-99, CLE, CLE7, LCRP369, RLLM1
Rabbit Polyclonal RTRAF Antibody against Human RNA transcription, translation and transport factor. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.05
NCBI: 51637
UniProt: Q9Y224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: AGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVG
WB Image Caption 1