Anti-NFKBID ChIP certified

Catalog Number: ATA-HPA054778
Article Name: Anti-NFKBID ChIP certified
Biozol Catalog Number: ATA-HPA054778
Supplier Catalog Number: HPA054778
Alternative Catalog Number: ATA-HPA054778-100,ATA-HPA054778-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IkappaBNS, TA-NFKBH
Clonality: Polyclonal
Isotype: IgG
NCBI: 84807
UniProt: Q8NI38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALH
Target: NFKBID
Antibody Type: Monoclonal Antibody
HPA054778-100ul