Anti-HSPB6

Catalog Number: ATA-HPA054811
Article Name: Anti-HSPB6
Biozol Catalog Number: ATA-HPA054811
Supplier Catalog Number: HPA054811
Alternative Catalog Number: ATA-HPA054811-100,ATA-HPA054811-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ32389, Hsp20, PPP1R91
heat shock protein, alpha-crystallin-related, B6
Anti-HSPB6
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 126393
UniProt: O14558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MEIPVPVQPSWLRRASAPLPGLSAPGRLFD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HSPB6
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-HSPB6 antibody. Corresponding HSPB6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human skin shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Skeletal muscle tissue
HPA054811-100ul
HPA054811-100ul
HPA054811-100ul