Anti-IDO2

Catalog Number: ATA-HPA054911
Article Name: Anti-IDO2
Biozol Catalog Number: ATA-HPA054911
Supplier Catalog Number: HPA054911
Alternative Catalog Number: ATA-HPA054911-100,ATA-HPA054911-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: INDOL1
Clonality: Polyclonal
Isotype: IgG
NCBI: 169355
UniProt: Q6ZQW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAHVDKMP
Target: IDO2
Antibody Type: Monoclonal Antibody
HPA054911-100ul