Anti-TMEM151B
Catalog Number:
ATA-HPA055167
- Images (7)
| Article Name: | Anti-TMEM151B |
| Biozol Catalog Number: | ATA-HPA055167 |
| Supplier Catalog Number: | HPA055167 |
| Alternative Catalog Number: | ATA-HPA055167-100,ATA-HPA055167-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bA444E17.5, C6orf137, TMEM193 |
| transmembrane protein 151B |
| Anti-TMEM151B |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 441151 |
| UniProt: | Q8IW70 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMEM151B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in nucleoli in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate positivity in nucleoli in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected. |
|
|
Immunohistochemical staining of human cerebellum shows moderate positivity in nucleoli in Purkinje cells. |
|
|
HPA055167-100ul |
|
|
HPA055167-100ul |
|
|
HPA055167-100ul |
Product Guarantee and Expert Support
