Anti-MMP11

Catalog Number: ATA-HPA055204
Article Name: Anti-MMP11
Biozol Catalog Number: ATA-HPA055204
Supplier Catalog Number: HPA055204
Alternative Catalog Number: ATA-HPA055204-100,ATA-HPA055204-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: STMY3
Clonality: Polyclonal
Concentration: 0,3
NCBI: 4320
UniProt: P24347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAFQDADGYAYF
Target: MMP11
HPA055204-100ul