Anti-CASQ2
Catalog Number:
ATA-HPA055298
- Images (9)
| Article Name: | Anti-CASQ2 |
| Biozol Catalog Number: | ATA-HPA055298 |
| Supplier Catalog Number: | HPA055298 |
| Alternative Catalog Number: | ATA-HPA055298-100,ATA-HPA055298-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PDIB2 |
| calsequestrin 2 (cardiac muscle) |
| Anti-CASQ2 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 845 |
| UniProt: | O14958 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CASQ2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human heart muscle and skin tissues using Anti-CASQ2 antibody. Corresponding CASQ2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle, lymph node, skeletal muscle and skin using Anti-CASQ2 antibody HPA055298 (A) shows similar protein distribution across tissues to independent antibody HPA027285 (B). |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Immunohistochemical staining of human heart muscle shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle using Anti-CASQ2 antibody HPA055298. |
|
|
Immunohistochemical staining of human lymph node using Anti-CASQ2 antibody HPA055298. |
|
|
HPA055298-100ul |
|
|
HPA055298-100ul |
|
|
HPA055298-100ul |
Product Guarantee and Expert Support
