Anti-HEXB
Catalog Number:
ATA-HPA055409
- Images (8)
| Article Name: | Anti-HEXB |
| Biozol Catalog Number: | ATA-HPA055409 |
| Supplier Catalog Number: | HPA055409 |
| Alternative Catalog Number: | ATA-HPA055409-100,ATA-HPA055409-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HEXB |
| hexosaminidase B (beta polypeptide) |
| Anti-HEXB |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3074 |
| UniProt: | P07686 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HEXB |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human colon, epididymis, kidney and liver using Anti-HEXB antibody HPA055409 (A) shows similar protein distribution across tissues to independent antibody HPA056010 (B). |
|
|
Immunohistochemical staining of human epididymis using Anti-HEXB antibody HPA055409. |
|
|
Immunohistochemical staining of human colon using Anti-HEXB antibody HPA055409. |
|
|
Immunohistochemical staining of human kidney using Anti-HEXB antibody HPA055409. |
|
|
Immunohistochemical staining of human liver using Anti-HEXB antibody HPA055409. |
|
|
HPA055409-100ul |
|
|
HPA055409-100ul |
|
|
HPA055409-100ul |
Product Guarantee and Expert Support
