Anti-TICAM1

Catalog Number: ATA-HPA055421
Article Name: Anti-TICAM1
Biozol Catalog Number: ATA-HPA055421
Supplier Catalog Number: HPA055421
Alternative Catalog Number: ATA-HPA055421-100,ATA-HPA055421-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC35334, PRVTIRB, TICAM-1, TRIF
Clonality: Polyclonal
Concentration: 0,05
NCBI: 148022
UniProt: Q8IUC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RLDKHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARM
Target: TICAM1
HPA055421-100ul