Anti-WDR46

Catalog Number: ATA-HPA055425
Article Name: Anti-WDR46
Biozol Catalog Number: ATA-HPA055425
Supplier Catalog Number: HPA055425
Alternative Catalog Number: ATA-HPA055425-100,ATA-HPA055425-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BING4, C6orf11, UTP7
Clonality: Polyclonal
Concentration: 0,05
NCBI: 9277
UniProt: O15213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV
Target: WDR46
HPA055425-100ul