Anti-MMP25

Catalog Number: ATA-HPA055640
Article Name: Anti-MMP25
Biozol Catalog Number: ATA-HPA055640
Supplier Catalog Number: HPA055640
Alternative Catalog Number: ATA-HPA055640-100,ATA-HPA055640-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MMP20, MMPL1, MT6-MMP
Clonality: Polyclonal
Isotype: IgG
NCBI: 64386
UniProt: Q9NPA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE
Target: MMP25
Antibody Type: Monoclonal Antibody
HPA055640-100ul