Anti-UACA

Catalog Number: ATA-HPA056006
Article Name: Anti-UACA
Biozol Catalog Number: ATA-HPA056006
Supplier Catalog Number: HPA056006
Alternative Catalog Number: ATA-HPA056006-100,ATA-HPA056006-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10128, KIAA1561
Clonality: Polyclonal
Isotype: IgG
NCBI: 55075
UniProt: Q9BZF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MTLNDTLAKTNRELLDVKKKFEDINQEFVKIKDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKK
Target: UACA
Antibody Type: Monoclonal Antibody
HPA056006-100ul