Anti-MME

Catalog Number: ATA-HPA056072
Article Name: Anti-MME
Biozol Catalog Number: ATA-HPA056072
Supplier Catalog Number: HPA056072
Alternative Catalog Number: ATA-HPA056072-100,ATA-HPA056072-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CALLA, CD10, NEP
membrane metallo-endopeptidase
Anti-MME
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 4311
UniProt: P08473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MME
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human small intestine and cerebral cortex tissues using Anti-MME antibody. Corresponding MME RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, prostate and small intestine using Anti-MME antibody HPA056072 (A) shows similar protein distribution across tissues to independent antibody HPA052583 (B).
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human small intestine shows high expression.
Immunohistochemical staining of human prostate using Anti-MME antibody HPA056072.
Immunohistochemical staining of human kidney using Anti-MME antibody HPA056072.
HPA056072-100ul
HPA056072-100ul
HPA056072-100ul