Anti-KNDC1

Catalog Number: ATA-HPA056143
Article Name: Anti-KNDC1
Biozol Catalog Number: ATA-HPA056143
Supplier Catalog Number: HPA056143
Alternative Catalog Number: ATA-HPA056143-100,ATA-HPA056143-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bB439H18.3, C10orf23, FLJ25027, KIAA1768, RASGEF2, v-KIND, Very-KIND
Clonality: Polyclonal
Isotype: IgG
NCBI: 85442
UniProt: Q76NI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ERLVTEKASVYCVAAVLWTAAKFSVPRNHKLALPRRLKTLLLDMARRSAPERPSAAEAIKVCGSYLLQRGMDSRKILAHLRASICQVYQ
Target: KNDC1
Antibody Type: Monoclonal Antibody
HPA056143-100ul