Anti-ADAMTS19

Catalog Number: ATA-HPA056171
Article Name: Anti-ADAMTS19
Biozol Catalog Number: ATA-HPA056171
Supplier Catalog Number: HPA056171
Alternative Catalog Number: ATA-HPA056171-100,ATA-HPA056171-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADAMTS19
ADAM metallopeptidase with thrombospondin type 1 motif, 19
Clonality: Polyclonal
Isotype: IgG
NCBI: 171019
UniProt: Q8TE59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EPLNDTMAITGHPHRVYRQKRSMEEKVTEKSALHSHYCGIISDKGRPRSRKIAESGRGKRYSYKLPQEYNIETVVVADPAMVSYHGAD
Target: ADAMTS19
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
HPA056171-100ul