Anti-ST14

Catalog Number: ATA-HPA056258
Article Name: Anti-ST14
Biozol Catalog Number: ATA-HPA056258
Supplier Catalog Number: HPA056258
Alternative Catalog Number: ATA-HPA056258-100,ATA-HPA056258-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAP3, HAI, MT-SP1, PRSS14, SNC19, TMPRSS14
Clonality: Polyclonal
Concentration: 0,05
NCBI: 6768
UniProt: Q9Y5Y6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
Target: ST14
HPA056258-100ul