Anti-TEX44, Rabbit, Polyclonal
Catalog Number:
ATA-HPA056433
- Images (9)
| Article Name: | Anti-TEX44, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA056433 |
| Supplier Catalog Number: | HPA056433 |
| Alternative Catalog Number: | ATA-HPA056433-25,ATA-HPA056433-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C2orf57, MGC35154 |
| testis expressed 44 |
| Anti-TEX44 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 165100 |
| UniProt: | Q53QW1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SHLLGKDKMSQMASVPEREPESAPSAPSAELQSTQHMEAQPVESDADHVTAGANGQHGPQAASTTKSAEEKAEHP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TEX44 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human testis and kidney tissues using Anti-TEX44 antibody. Corresponding TEX44 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-TEX44 antibody HPA056433 (A) shows similar protein distribution across tissues to independent antibody HPA049917 (B). |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TEX44 antibody HPA056433. |
|
|
Immunohistochemical staining of human lymph node using Anti-TEX44 antibody HPA056433. |
|
|
HPA056433 |
|
|
HPA056433 |
|
|
HPA056433 |
Product Guarantee and Expert Support
