Anti-SLK

Catalog Number: ATA-HPA056556
Article Name: Anti-SLK
Biozol Catalog Number: ATA-HPA056556
Supplier Catalog Number: HPA056556
Alternative Catalog Number: ATA-HPA056556-100,ATA-HPA056556-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0204, se20-9, STK2
Clonality: Polyclonal
Concentration: 0,05
NCBI: 9748
UniProt: Q9H2G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KEPEVTVVSQPTEPQPVLIPSININSDSGENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSFLSK
Target: SLK
HPA056556-100ul