Anti-PNOC, Rabbit, Polyclonal
Catalog Number:
ATA-HPA056724
- Images (9)
| Article Name: | Anti-PNOC, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA056724 |
| Supplier Catalog Number: | HPA056724 |
| Alternative Catalog Number: | ATA-HPA056724-25,ATA-HPA056724-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | N/OFQ, NOP, PPNOC |
| prepronociceptin |
| Anti-PNOC |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 5368 |
| UniProt: | Q13519 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PNOC |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and colon tissues using Anti-PNOC antibody. Corresponding PNOC RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-PNOC antibody HPA056724 (A) shows similar protein distribution across tissues to independent antibody HPA044507 (B). |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human testis using Anti-PNOC antibody HPA056724. |
|
|
Immunohistochemical staining of human liver using Anti-PNOC antibody HPA056724. |
|
|
HPA056724 |
|
|
HPA056724 |
|
|
HPA056724 |
Product Guarantee and Expert Support
