Anti-DBN1

Catalog Number: ATA-HPA056940
Article Name: Anti-DBN1
Biozol Catalog Number: ATA-HPA056940
Supplier Catalog Number: HPA056940
Alternative Catalog Number: ATA-HPA056940-100,ATA-HPA056940-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: D0S117E
drebrin 1
Anti-DBN1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1627
UniProt: Q16643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DBN1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-DBN1 antibody. Corresponding DBN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-DBN1 antibody HPA056940 (A) shows similar protein distribution across tissues to independent antibody HPA051452 (B).
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human testis using Anti-DBN1 antibody HPA056940.
Immunohistochemical staining of human kidney using Anti-DBN1 antibody HPA056940.
HPA056940-100ul
HPA056940-100ul
HPA056940-100ul