Anti-NYAP2

Catalog Number: ATA-HPA056945
Article Name: Anti-NYAP2
Biozol Catalog Number: ATA-HPA056945
Supplier Catalog Number: HPA056945
Alternative Catalog Number: ATA-HPA056945-100,ATA-HPA056945-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1486
Clonality: Polyclonal
Isotype: IgG
NCBI: 57624
UniProt: Q9P242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YDAVHSGSLSRSSPSVPHSTPRPVSQDGAKMVNAAVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSG
Target: NYAP2
Antibody Type: Monoclonal Antibody
HPA056945-100ul