Anti-PGM2L1

Catalog Number: ATA-HPA056995
Article Name: Anti-PGM2L1
Biozol Catalog Number: ATA-HPA056995
Supplier Catalog Number: HPA056995
Alternative Catalog Number: ATA-HPA056995-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BM32A, FLJ32029
phosphoglucomutase 2-like 1
Anti-PGM2L1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 283209
UniProt: Q6PCE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PGM2L1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-PGM2L1 antibody. Corresponding PGM2L1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
HPA056995-100ul
HPA056995-100ul
HPA056995-100ul