Anti-TMTC4

Catalog Number: ATA-HPA057056
Article Name: Anti-TMTC4
Biozol Catalog Number: ATA-HPA057056
Supplier Catalog Number: HPA057056
Alternative Catalog Number: ATA-HPA057056-100,ATA-HPA057056-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ14624, FLJ22153
Clonality: Polyclonal
Isotype: IgG
NCBI: 84899
UniProt: Q5T4D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYY
Target: TMTC4
Antibody Type: Monoclonal Antibody
HPA057056-100ul