Anti-ASIC4

Catalog Number: ATA-HPA057078
Article Name: Anti-ASIC4
Biozol Catalog Number: ATA-HPA057078
Supplier Catalog Number: HPA057078
Alternative Catalog Number: ATA-HPA057078-100,ATA-HPA057078-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ACCN4, BNAC4
Clonality: Polyclonal
Isotype: IgG
NCBI: 55515
UniProt: Q96FT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GLLAREGQGREALASPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLH
Target: ASIC4
Antibody Type: Monoclonal Antibody
HPA057078-100ul