Anti-SAT2

Catalog Number: ATA-HPA057096
Article Name: Anti-SAT2
Biozol Catalog Number: ATA-HPA057096
Supplier Catalog Number: HPA057096
Alternative Catalog Number: ATA-HPA057096-100,ATA-HPA057096-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SSAT2
spermidine/spermine N1-acetyltransferase family member 2
Anti-SAT2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 112483
UniProt: Q96F10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SAT2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-SAT2 antibody. Corresponding SAT2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland, colon, pancreas and small intestine using Anti-SAT2 antibody HPA057096 (A) shows similar protein distribution across tissues to independent antibody HPA022136 (B).
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human colon using Anti-SAT2 antibody HPA057096.
Immunohistochemical staining of human small intestine using Anti-SAT2 antibody HPA057096.
HPA057096-100ul
HPA057096-100ul
HPA057096-100ul