Anti-SAT2, Rabbit, Polyclonal
Catalog Number:
ATA-HPA057096
- Images (9)
| Article Name: | Anti-SAT2, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA057096 |
| Supplier Catalog Number: | HPA057096 |
| Alternative Catalog Number: | ATA-HPA057096-25,ATA-HPA057096-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SSAT2 |
| spermidine/spermine N1-acetyltransferase family member 2 |
| Anti-SAT2 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 112483 |
| UniProt: | Q96F10 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SAT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-SAT2 antibody. Corresponding SAT2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland, colon, pancreas and small intestine using Anti-SAT2 antibody HPA057096 (A) shows similar protein distribution across tissues to independent antibody HPA022136 (B). |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human colon using Anti-SAT2 antibody HPA057096. |
|
|
Immunohistochemical staining of human small intestine using Anti-SAT2 antibody HPA057096. |
|
|
HPA057096 |
|
|
HPA057096 |
|
|
HPA057096 |
Product Guarantee and Expert Support
