Anti-SYNPO2L Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SYNPO2L Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA057142
• Supplier Catalog Number: HPA057142
• Alternative Catalog Number: ATA-HPA057142-100,ATA-HPA057142-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ12921

Product Properties

• Clonality: Polyclonal
• NCBI: 79933
• UniProt: Q9H987
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PVAPKPPSRGLLDGLVNGAASSAGIPEPPRLQGRGGELFAKRQSRADRYVVEGTPGPGLGPR
• Target: SYNPO2L