Anti-AK5

Catalog Number: ATA-HPA057255
Article Name: Anti-AK5
Biozol Catalog Number: ATA-HPA057255
Supplier Catalog Number: HPA057255
Alternative Catalog Number: ATA-HPA057255-100,ATA-HPA057255-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AK5
adenylate kinase 5
Anti-AK5
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 26289
UniProt: Q9Y6K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: AK5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-AK5 antibody. Corresponding AK5 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA057255-100ul
HPA057255-100ul
HPA057255-100ul