Anti-LPCAT4

Catalog Number: ATA-HPA057321
Article Name: Anti-LPCAT4
Biozol Catalog Number: ATA-HPA057321
Supplier Catalog Number: HPA057321
Alternative Catalog Number: ATA-HPA057321-100,ATA-HPA057321-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AGPAT7, AYTL3, FLJ10257, LPAAT-eta, LPEAT2
Clonality: Polyclonal
Isotype: IgG
NCBI: 254531
UniProt: Q643R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDT
Target: LPCAT4
Antibody Type: Monoclonal Antibody
HPA057321-100ul