Anti-DSCAM

Catalog Number: ATA-HPA057493
Article Name: Anti-DSCAM
Biozol Catalog Number: ATA-HPA057493
Supplier Catalog Number: HPA057493
Alternative Catalog Number: ATA-HPA057493-100,ATA-HPA057493-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CHD2-42, CHD2-52
Clonality: Polyclonal
Isotype: IgG
NCBI: 1826
UniProt: O60469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK
Target: DSCAM
Antibody Type: Monoclonal Antibody
HPA057493-100ul