Anti-SHLD2

Catalog Number: ATA-HPA057506
Article Name: Anti-SHLD2
Biozol Catalog Number: ATA-HPA057506
Supplier Catalog Number: HPA057506
Alternative Catalog Number: ATA-HPA057506-100,ATA-HPA057506-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2
Clonality: Polyclonal
Concentration: 0,6
NCBI: 54537
UniProt: Q86V20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLEL
Target: SHLD2
HPA057506-100ul