Anti-DNA2

Catalog Number: ATA-HPA057526
Article Name: Anti-DNA2
Biozol Catalog Number: ATA-HPA057526
Supplier Catalog Number: HPA057526
Alternative Catalog Number: ATA-HPA057526-100,ATA-HPA057526-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DNA2L, KIAA0083
DNA replication helicase/nuclease 2
Anti-DNA2
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 1763
UniProt: P51530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNA2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
HPA057526-100ul