Anti-EFCAB12

Catalog Number: ATA-HPA057532
Article Name: Anti-EFCAB12
Biozol Catalog Number: ATA-HPA057532
Supplier Catalog Number: HPA057532
Alternative Catalog Number: ATA-HPA057532-100,ATA-HPA057532-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C3orf25
Clonality: Polyclonal
Isotype: IgG
NCBI: 90288
UniProt: Q6NXP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLKVKRSSGLQQTHPNSFWPGHL
Target: EFCAB12
Antibody Type: Monoclonal Antibody
HPA057532-100ul