Anti-LRRC23

Catalog Number: ATA-HPA057533
Article Name: Anti-LRRC23
Biozol Catalog Number: ATA-HPA057533
Supplier Catalog Number: HPA057533
Alternative Catalog Number: ATA-HPA057533-100,ATA-HPA057533-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: B7, LRPB7
leucine rich repeat containing 23
Anti-LRRC23
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 10233
UniProt: Q53EV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LKADGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPKLKNLYLA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LRRC23
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A549 shows localization to nucleoli.
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-LRRC23 antibody. Corresponding LRRC23 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA057533-100ul
HPA057533-100ul
HPA057533-100ul