Anti-TIGD6

Catalog Number: ATA-HPA057538
Article Name: Anti-TIGD6
Biozol Catalog Number: ATA-HPA057538
Supplier Catalog Number: HPA057538
Alternative Catalog Number: ATA-HPA057538-100,ATA-HPA057538-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp761E2110
Clonality: Polyclonal
Concentration: 0,05
NCBI: 81789
UniProt: Q17RP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MANKGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRMRSALYDDIDKAVFAWFQEIHAK
Target: TIGD6
HPA057538-100ul