Anti-CHODL

Catalog Number: ATA-HPA057559
Article Name: Anti-CHODL
Biozol Catalog Number: ATA-HPA057559
Supplier Catalog Number: HPA057559
Alternative Catalog Number: ATA-HPA057559-100,ATA-HPA057559-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C21orf68, FLJ12627, MT75, PRED12
Clonality: Polyclonal
Isotype: IgG
NCBI: 140578
UniProt: Q9H9P2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQ
Target: CHODL
Antibody Type: Monoclonal Antibody
HPA057559-100ul