Anti-PICK1
Catalog Number:
ATA-HPA057619
| Article Name: |
Anti-PICK1 |
| Biozol Catalog Number: |
ATA-HPA057619 |
| Supplier Catalog Number: |
HPA057619 |
| Alternative Catalog Number: |
ATA-HPA057619-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
dJ1039K5, MGC15204, PRKCABP |
| Rabbit Polyclonal PICK1 Antibody against Human protein interacting with PRKCA 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.05 |
| NCBI: |
9463 |
| UniProt: |
Q9NRD5 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD |
|
WB Image Caption 1 |