Anti-COA5
Catalog Number:
ATA-HPA057768
- Images (8)
| Article Name: | Anti-COA5 |
| Biozol Catalog Number: | ATA-HPA057768 |
| Supplier Catalog Number: | HPA057768 |
| Alternative Catalog Number: | ATA-HPA057768-100,ATA-HPA057768-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C2orf64, FLJ27524, MGC52110, Pet191 |
| cytochrome c oxidase assembly factor 5 |
| Anti-COA5 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 493753 |
| UniProt: | Q86WW8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COA5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HepG2 |
|
|
HPA057768 |
|
|
HPA057768-100ul |
|
|
HPA057768 |
|
|
HPA057768-100ul |
|
|
HPA057768-100ul |
Product Guarantee and Expert Support
