Anti-ST8SIA2

Catalog Number: ATA-HPA057819
Article Name: Anti-ST8SIA2
Biozol Catalog Number: ATA-HPA057819
Supplier Catalog Number: HPA057819
Alternative Catalog Number: ATA-HPA057819-100,ATA-HPA057819-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HsT19690, SIAT8B, ST8SIA-II, STX
Clonality: Polyclonal
Isotype: IgG
NCBI: 8128
UniProt: Q92186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI
Target: ST8SIA2
Antibody Type: Monoclonal Antibody
HPA057819-100ul