Anti-PEX3

Catalog Number: ATA-HPA058006
Article Name: Anti-PEX3
Biozol Catalog Number: ATA-HPA058006
Supplier Catalog Number: HPA058006
Alternative Catalog Number: ATA-HPA058006-100,ATA-HPA058006-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PEX3
peroxisomal biogenesis factor 3
Anti-PEX3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 8504
UniProt: P56589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PEX3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-PEX3 antibody. Corresponding PEX3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and PEX3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401203).
HPA058006-100ul
HPA058006-100ul
HPA058006-100ul