Anti-PEX5L
Catalog Number:
ATA-HPA058026
- Images (7)
| Article Name: | Anti-PEX5L |
| Biozol Catalog Number: | ATA-HPA058026 |
| Supplier Catalog Number: | HPA058026 |
| Alternative Catalog Number: | ATA-HPA058026-100,ATA-HPA058026-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PEX5R, PXR2 |
| peroxisomal biogenesis factor 5-like |
| Anti-PEX5L |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 51555 |
| UniProt: | Q8IYB4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PVTSNTAVLTTGLDLLDLSEPVSQTQTKAKKSEPSSKTSSLKKKADGSDLISTDAEQRGQPLRVPETSSLDLDIQTQLEKWDDVKFHGDRNTKG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PEX5L |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-PEX5L antibody. Corresponding PEX5L RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human anterior pituitary gland shows strong cytoplasmic positivity in endocrine cells. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA058026-100ul |
|
|
HPA058026-100ul |
|
|
HPA058026-100ul |
Product Guarantee and Expert Support
