Anti-BAZ1B

Catalog Number: ATA-HPA058068
Article Name: Anti-BAZ1B
Biozol Catalog Number: ATA-HPA058068
Supplier Catalog Number: HPA058068
Alternative Catalog Number: ATA-HPA058068-100,ATA-HPA058068-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: WBSCR10, WBSCR9, WSTF
Clonality: Polyclonal
Concentration: 0,1
NCBI: 9031
UniProt: Q9UIG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVS
Target: BAZ1B
HPA058068-100ul