Anti-GABRG1

Catalog Number: ATA-HPA058102
Article Name: Anti-GABRG1
Biozol Catalog Number: ATA-HPA058102
Supplier Catalog Number: HPA058102
Alternative Catalog Number: ATA-HPA058102-100,ATA-HPA058102-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 2565
UniProt: Q8N1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC
Target: GABRG1
Antibody Type: Monoclonal Antibody
HPA058102-100ul