Anti-DOCK10

Catalog Number: ATA-HPA058106
Article Name: Anti-DOCK10
Biozol Catalog Number: ATA-HPA058106
Supplier Catalog Number: HPA058106
Alternative Catalog Number: ATA-HPA058106-100,ATA-HPA058106-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0694, ZIZ3
dedicator of cytokinesis 10
Anti-DOCK10
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 55619
UniProt: Q96BY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKTTRNMERLNLFSLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DOCK10
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using Anti-DOCK10 antibody. Corresponding DOCK10 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA058106-100ul
HPA058106-100ul
HPA058106-100ul