Anti-PPIL6

Catalog Number: ATA-HPA058165
Article Name: Anti-PPIL6
Biozol Catalog Number: ATA-HPA058165
Supplier Catalog Number: HPA058165
Alternative Catalog Number: ATA-HPA058165-100,ATA-HPA058165-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA425D10.6, dJ919F19.1, MGC41939, RSPH12
Clonality: Polyclonal
Isotype: IgG
NCBI: 285755
UniProt: Q8IXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEGTEVLKQLELVPTQNERPI
Target: PPIL6
Antibody Type: Monoclonal Antibody
HPA058165-100ul