Anti-BANK1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-BANK1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA058190
• Supplier Catalog Number: HPA058190
• Alternative Catalog Number: ATA-HPA058190-100,ATA-HPA058190-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: BANK, FLJ20706

Product Description

Rabbit Polyclonal BANK1 Antibody against Human B cell scaffold protein with ankyrin repeats 1. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2
• NCBI: 55024
• UniProt: Q8NDB2
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: IGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLCQNSIEELDGVL