Anti-BANK1
Catalog Number:
ATA-HPA058190
| Article Name: |
Anti-BANK1 |
| Biozol Catalog Number: |
ATA-HPA058190 |
| Supplier Catalog Number: |
HPA058190 |
| Alternative Catalog Number: |
ATA-HPA058190-100,ATA-HPA058190-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
BANK, FLJ20706 |
| Rabbit Polyclonal BANK1 Antibody against Human B cell scaffold protein with ankyrin repeats 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 |
| NCBI: |
55024 |
| UniProt: |
Q8NDB2 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
IGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLCQNSIEELDGVL |
|
WB Image Caption 1 |