Anti-BANK1

Catalog Number: ATA-HPA058190
Article Name: Anti-BANK1
Biozol Catalog Number: ATA-HPA058190
Supplier Catalog Number: HPA058190
Alternative Catalog Number: ATA-HPA058190-100,ATA-HPA058190-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: BANK, FLJ20706
Rabbit Polyclonal BANK1 Antibody against Human B cell scaffold protein with ankyrin repeats 1. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.2
NCBI: 55024
UniProt: Q8NDB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: IGDTVEVEFTSSNKRIRTRPALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLCQNSIEELDGVL
WB Image Caption 1