Anti-DNAH12

Product Overview

• Article Name: Anti-DNAH12
• Biozol Catalog Number: ATA-HPA058203
• Supplier Catalog Number: HPA058203
• Alternative Catalog Number: ATA-HPA058203-100,ATA-HPA058203-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Molekularbiologie
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19

Product Description

dynein, axonemal, heavy chain 12

Additional Information

Anti-DNAH12

Product Properties

• Clonality: Polyclonal
• Concentration: 0.4 mg/ml
• Isotype: IgG
• NCBI: 201625
• UniProt: Q6ZR08
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKII
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DNAH12
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DNAH12 antibody. Corresponding DNAH12 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, fallopian tube, liver and prostate using Anti-DNAH12 antibody HPA058203 (A) shows similar protein distribution across tissues to independent antibody HPA037493 (B).

Immunohistochemical staining of human prostate shows low expression as expected.

Immunohistochemical staining of human fallopian tube shows high expression.

Immunohistochemical staining of human liver using Anti-DNAH12 antibody HPA058203.

Immunohistochemical staining of human cerebral cortex using Anti-DNAH12 antibody HPA058203.

HPA058203-100ul

HPA058203-100ul

HPA058203-100ul