Anti-CUTC

Catalog Number: ATA-HPA058231
Article Name: Anti-CUTC
Biozol Catalog Number: ATA-HPA058231
Supplier Catalog Number: HPA058231
Alternative Catalog Number: ATA-HPA058231-100,ATA-HPA058231-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CGI-32
Clonality: Polyclonal
Isotype: IgG
NCBI: 51076
UniProt: Q9NTM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCD
Target: CUTC
Antibody Type: Monoclonal Antibody
HPA058231-100ul