Anti-LECT2

Catalog Number: ATA-HPA058246
Article Name: Anti-LECT2
Biozol Catalog Number: ATA-HPA058246
Supplier Catalog Number: HPA058246
Alternative Catalog Number: ATA-HPA058246-100,ATA-HPA058246-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: chm-II, chm2
Clonality: Polyclonal
Isotype: IgG
NCBI: 3950
UniProt: O14960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ
Target: LECT2
Antibody Type: Monoclonal Antibody
HPA058246-100ul