Anti-SLCO4C1

Catalog Number: ATA-HPA058249
Article Name: Anti-SLCO4C1
Biozol Catalog Number: ATA-HPA058249
Supplier Catalog Number: HPA058249
Alternative Catalog Number: ATA-HPA058249-100,ATA-HPA058249-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: OATP-H, OATP4C1, OATPX, SLC21A20
Clonality: Polyclonal
Isotype: IgG
NCBI: 353189
UniProt: Q6ZQN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAALKNLMK
Target: SLCO4C1
Antibody Type: Monoclonal Antibody
HPA058249-100ul